PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10001715m
Common NameCICLE_v10001715mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 346aa    MW: 38039.2 Da    PI: 9.7547
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10001715mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.71.4e-09183241563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr++r   NR +A rs +RK  ++ eLe+kv++L++e ++L  ++ +l+     l++e+
  Ciclev10001715m 183 KRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAEN 241
                      9********************************************99998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-16179243IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.013181244IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-11183237No hitNo description
PfamPF001703.5E-8183237IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11183235No hitNo description
CDDcd147031.85E-23184233No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007231Biological Processosmosensory signaling pathway
GO:0008272Biological Processsulfate transport
GO:0009294Biological ProcessDNA mediated transformation
GO:0009652Biological Processthigmotropism
GO:0009970Biological Processcellular response to sulfate starvation
GO:0045596Biological Processnegative regulation of cell differentiation
GO:0051170Biological Processnuclear import
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
GO:0051019Molecular Functionmitogen-activated protein kinase binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MNPSKTTGKQ PMAVDIDDMP ETPQHRGIHH RRAHSDTSFR FDDFLLFDPS DLDLSALDLP  60
SPNPTPPRGV PMALDSSEDS SSNSHGQKQQ KQSQNPPKPK PINHLRSLSV DSDFFDSLGL  120
TSPASGGGAG NSAAGAGGGG EKRSYHRHSN SMDGFEVESI LGDGVKKAVD RDRLAELALI  180
DPKRAKRILA NRQSAARSKE RKIRYTSELE RKVQTLQTEA TTLSAQVTML QRDTTGLTAE  240
NKELKLRLQA MEQQAHLRDA LNEALREEVQ RLKIATGQIP AANGNPFGRG LPPQFPSHQQ  300
AMHNFGGPQT QQQQQQQQQQ VPQPSTNNQT HGQSRPNFMD FNQRV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00184DAPTransfer from AT1G43700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1482225e-88EF148222.1 Populus trichocarpa clone WS0128_N17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006434439.10.0hypothetical protein CICLE_v10001715mg
SwissprotQ9MA751e-96VIP1_ARATH; Transcription factor VIP1
TrEMBLV4V6M50.0V4V6M5_9R
STRINGPOPTR_0005s21300.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79932639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.12e-68VIRE2-interacting protein 1